PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc03866.1.g00030.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 541aa    MW: 58232.5 Da    PI: 10.4778
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc03866.1.g00030.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding543.8e-17265312148
                                   TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
               Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                   +g+WT+eEd+ lv +v+++G+g+W++++   g+ R+ k+c++rw +yl
  Zmw_sc03866.1.g00030.1.am.mk 265 KGPWTPEEDLVLVSYVQEHGPGNWRAVPTNTGLMRCSKSCRLRWTNYL 312
                                   79********************************************97 PP

2Myb_DNA-binding50.35.5e-16318363148
                                   TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
               Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                   rg++T +E++l+v++ ++lG++ W++Ia++++  Rt++++k++w+++l
  Zmw_sc03866.1.g00030.1.am.mk 318 RGNFTDQEEKLIVHLQALLGNR-WAAIASYLP-ERTDNDIKNYWNTHL 363
                                   89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.3E-23256315IPR009057Homeodomain-like
PROSITE profilePS5129417.846260312IPR017930Myb domain
SuperFamilySSF466891.17E-29262359IPR009057Homeodomain-like
SMARTSM007174.0E-13264314IPR001005SANT/Myb domain
PfamPF002497.5E-16265312IPR001005SANT/Myb domain
CDDcd001674.12E-11267312No hitNo description
PROSITE profilePS5129424.722313367IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.8E-24316367IPR009057Homeodomain-like
SMARTSM007174.3E-16317365IPR001005SANT/Myb domain
PfamPF002491.1E-14318363IPR001005SANT/Myb domain
CDDcd001671.50E-11320363No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 541 aa     Download sequence    Send to blast
MQGDRFNFQL KNKRAFRCSG TRAVPSRPNR PKTWNHSFTA DEIRPAATSR PEELQNSAGT  60
KAPSVTPRDS RAAHMSALQA ACTARRLPPH TQARAVEITV FHQDNNGKRQ DFTRTKSLVR  120
SHEASPQFIP ACARRPARGL VCFARTKQAN TVTAACARAA DASASAAVVA SLTRDAGAGV  180
SRRVFGRGSR AGSVAVPGGV CWIGRGHSQP GTRQRLYNPP ESGADRTRSV TRSRLAILAW  240
TLGVVDWEER RMGRPPCCEK GGVKKGPWTP EEDLVLVSYV QEHGPGNWRA VPTNTGLMRC  300
SKSCRLRWTN YLRPGIKRGN FTDQEEKLIV HLQALLGNRW AAIASYLPER TDNDIKNYWN  360
THLKKKLGKM SIGGEDEESK LTAPKGQWER QLQTDIHTAR QALRGALSMD TSSPAPAAKP  420
EAHAPAPVGQ ATYASSTENI ARLLEEWMRP GAGNGGKTSS GPSGSSPSAV SGEGASAASQ  480
SGAARTLEGS TGTGGKAEDR GAVVAPGPAF SMLENWLLDD GMEHGDVGIM GMPLADPCDF  540
F
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C7e-252653674105C-Myb DNA-Binding Domain
1msf_C7e-252653674105C-Myb DNA-Binding Domain
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003574549.11e-129PREDICTED: transcription factor MYB30-like
SwissprotP813921e-100MYB06_ANTMA; Myb-related protein 306
TrEMBLI1I7G11e-129I1I7G1_BRADI; Uncharacterized protein
STRINGBRADI3G37047.11e-128(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22938296